GRPE_VIBCH grpE VC_0854 HSP-70 cofactor Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with dnaK and grpE. It is the nucleotide exchange factor for dnaK and may function as a thermosensor. Unfolded proteins bind initially to dnaJ; upon interaction with the dnaJ-bound protein, dnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from dnaK; ATP binding to dnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP- dependent interactions between dnaJ, dnaK and grpE are required for fully efficient folding (By similarity). Protein grpE 200 MSNEEIKNKDEQLQQDAVETEAEVVGTDADIDWNQAADEIDEKEAKIAQLEAALLVSEERVKEQQDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEVEAIKPLLEGVELTHKTFVDTIAKFGLKEINPHGEVFNPEFHQAMSIQESAEHEPNTVMFVMQKGYELNGRVLRPAMVMVSK